Cytochrome C Comparison Lab Answer Key

Cytochrome c, a small heme protein found in the intermembrane space of the mitochondria, plays a vital role in the electron transport chain, specifically in transferring electrons between complex III and complex IV. Its highly conserved nature across diverse species makes it a powerful tool for studying evolutionary relationships. The cytochrome c comparison lab aims to explore these evolutionary connections by analyzing the amino acid sequences of cytochrome c from different organisms.

Understanding Cytochrome c: A Molecular Clock

Cytochrome c acts as a molecular clock. The rate at which mutations accumulate in its amino acid sequence is relatively constant over time. This consistent rate allows scientists to estimate how long ago different species diverged from a common ancestor. The more similar the cytochrome c sequences between two species, the more recently they shared a common ancestor. Conversely, greater differences in the sequences indicate a more distant evolutionary relationship.

Principles of Cytochrome c Comparison Lab

The cytochrome c comparison lab operates on several core principles:

• Sequence Alignment: The foundation of the lab involves aligning the amino acid sequences of cytochrome c from different species. This alignment identifies conserved regions (identical amino acids across species) and variable regions (amino acids that differ).
• Calculating Differences: The number of amino acid differences between the cytochrome c sequences of two species reflects their evolutionary distance. A higher number of differences indicates a greater evolutionary separation.
• Phylogenetic Tree Construction: By comparing cytochrome c sequences across multiple species, scientists can construct phylogenetic trees. These trees visually represent the evolutionary relationships between species, showing how they are related based on the similarities and differences in their cytochrome c.
• Molecular Clock Hypothesis: The molecular clock hypothesis suggests that the rate of mutation in cytochrome c is relatively constant. This allows scientists to estimate the time since two species diverged by calibrating the rate of change with known fossil records or geological events.

Importance of Cytochrome c in Evolutionary Studies

Cytochrome c is particularly useful in evolutionary studies due to several key factors:

1. Ubiquitous Presence: Cytochrome c is found in almost all eukaryotic organisms, making it widely available for comparative studies.
2. High Conservation: Despite its presence in diverse species, cytochrome c has a highly conserved amino acid sequence. This conservation allows for meaningful comparisons across distantly related organisms.
3. Well-Defined Function: The function of cytochrome c in the electron transport chain is well-understood, which helps in interpreting the functional significance of amino acid changes.
4. Moderate Size: The relatively small size of the cytochrome c protein (around 100-104 amino acids) makes it easier to sequence and analyze compared to larger proteins.

Step-by-Step Guide to a Cytochrome c Comparison Lab

A typical cytochrome c comparison lab involves the following steps:

1. Obtaining Cytochrome c Sequences

• Database Retrieval: Cytochrome c amino acid sequences are readily available in online databases like the National Center for Biotechnology Information (NCBI). Students will typically be provided with a set of sequences from different organisms (e.g., human, chimpanzee, horse, chicken, yeast).
• Sequence Format: Sequences are usually in FASTA format, a text-based format representing nucleotide or amino acid sequences. Each sequence begins with a header line (">") containing the organism's name and a unique identifier, followed by the amino acid sequence.

2. Sequence Alignment

• Software Tools: Sequence alignment is performed using bioinformatics tools such as ClustalW, MUSCLE, or online alignment servers like EMBL-EBI. These tools use algorithms to find the best possible alignment of multiple sequences, maximizing the number of matching amino acids.
• Alignment Process: Load the sequences into the alignment software and run the alignment algorithm. The software will output an alignment showing the sequences aligned with gaps ("-") inserted to maximize the number of matching amino acids.
• Visual Inspection: Examine the alignment to identify conserved and variable regions. Conserved regions will have identical amino acids across most or all species, while variable regions will have different amino acids.

3. Calculating Amino Acid Differences

• Pairwise Comparison: For each pair of species, count the number of amino acid positions where the amino acids differ. Ignore positions with gaps ("-").
• Creating a Distance Matrix: Organize the number of differences into a distance matrix. The matrix will have the species names along both axes, and each cell will contain the number of amino acid differences between the corresponding pair of species.
• Example:

  Species	Human	Chimpanzee	Horse	Chicken
  Human	0	1	12	13
  Chimpanzee	1	0	11	12
  Horse	12	11	0	3
  Chicken	13	12	3	0

4. Constructing a Phylogenetic Tree

• Tree-Building Methods: Use the distance matrix to construct a phylogenetic tree. Common methods include UPGMA (Unweighted Pair Group Method with Arithmetic Mean) and Neighbor-Joining. These methods group species based on their similarity, creating a tree that reflects their evolutionary relationships.
• Software Tools: Phylogenetic tree construction can be done using software like MEGA (Molecular Evolutionary Genetics Analysis) or online tools like Phylodendron.
• Tree Interpretation: The phylogenetic tree shows the relationships between the species. Species that are closely related (i.e., have few amino acid differences) will be located close to each other on the tree, while distantly related species will be farther apart. The branch lengths in the tree can be proportional to the number of amino acid differences.

5. Analysis and Interpretation

• Evolutionary Relationships: Analyze the phylogenetic tree to identify the evolutionary relationships between the species. Discuss which species are most closely related and which are most distantly related.
• Rate of Evolution: Estimate the rate of evolution of cytochrome c by comparing the number of amino acid differences between species with known divergence times (obtained from fossil records or other sources).
• Functional Significance: Discuss the possible functional significance of the amino acid differences. Are the differences located in regions of the protein that are important for its function? Do the differences affect the protein's structure or stability?

Example of a Cytochrome c Comparison Lab: Answer Key

Let’s illustrate a simplified example with a hypothetical set of cytochrome c sequences from five species: human, chimpanzee, rhesus monkey, horse, and pigeon.

1. Hypothetical Cytochrome c Sequences (Simplified)

• Human: G D V E K G K K I F I M K C S Q C H T V E K G G K H K G P N L H G G Q
• Chimpanzee: G D V E K G K K I F I M K C S Q C H T V E K G G K H K G P N L H G G Q
• Rhesus Monkey: G D V E K G K K I F V M K C S Q C H T V E K G G K H K G P N L H G G Q
• Horse: G D V E K G K K I F V Q K C A Q C H T V D K G G K H K G P N L N G G Q
• Pigeon: G D I E K G K K I F V Q K C S Q C H T A E K G G K H K G P N L N G G Q

2. Sequence Alignment

Using sequence alignment software, the sequences are aligned:

Human:       GDVEKGKKIFIMKCSQCHTVEKGGKHKGPNLHGGQ
Chimpanzee:  GDVEKGKKIFIMKCSQCHTVEKGGKHKGPNLHGGQ
Rhesus:      GDVEKGKKIFVMKCSQCHTVEKGGKHKGPNLHGGQ
Horse:       GDVEKGKKIFVQKC-AQCHTVEKGGKHKGPNL-NGGQ
Pigeon:      GDIEKGKKIFVQKCSQCHTAEKGGKHKGPNL-NGGQ

3. Calculating Amino Acid Differences

Creating a distance matrix based on the alignment:

Species	Human	Chimpanzee	Rhesus	Horse	Pigeon
Human	0	0	1	3	4
Chimpanzee	0	0	1	3	4
Rhesus Monkey	1	1	0	3	4
Horse	3	3	3	0	2
Pigeon	4	4	4	2	0

4. Phylogenetic Tree Construction

Using a tree-building method (e.g., UPGMA), the phylogenetic tree would look something like this (simplified):

      |--- Human
      |
      |--- Chimpanzee
  |---|
  |   |--- Rhesus Monkey
--|
  |   |--- Horse
  |---|
      |--- Pigeon

5. Analysis and Interpretation

• Evolutionary Relationships:
  • Human and chimpanzee have identical cytochrome c sequences, indicating a very close evolutionary relationship.
  • Rhesus monkey is slightly more distant from humans and chimpanzees, with one amino acid difference.
  • Horse is more distant from the primates, with three amino acid differences.
  • Pigeon is the most distant, with four amino acid differences from human and chimpanzee.
• Rate of Evolution (Hypothetical):
  • If we know that humans and chimpanzees diverged approximately 6 million years ago (mya), and there are 0 differences, it reflects the high conservation.
  • If humans and horses diverged around 90 mya, the 3 differences can be used to estimate a rough evolutionary rate (though more data points would be needed for a more accurate estimation).
• Functional Significance:
  • The amino acid differences between the species might affect the efficiency or regulation of electron transport. However, without further biochemical analysis, it is difficult to determine the exact functional consequences.

Common Pitfalls and Considerations

1. Sequence Quality: Ensure the cytochrome c sequences are accurate and complete. Errors in the sequences can lead to incorrect results.
2. Alignment Accuracy: The accuracy of the sequence alignment is crucial. Poorly aligned sequences can lead to incorrect estimates of amino acid differences. Experiment with different alignment algorithms and parameters to optimize the alignment.
3. Horizontal Gene Transfer: While rare in eukaryotes, horizontal gene transfer can complicate phylogenetic analysis. Be aware of the possibility of gene transfer events and their potential impact on the results.
4. Molecular Clock Assumptions: The molecular clock hypothesis assumes a constant rate of mutation. However, the rate of mutation can vary across different lineages and genes. Calibrate the molecular clock using multiple data points to improve accuracy.
5. Sampling Bias: The choice of species included in the analysis can affect the results. Include a diverse set of species to get a more comprehensive picture of evolutionary relationships.

Addressing Common Questions (FAQ)

• Why is Cytochrome c so Conserved?
  • Cytochrome c's role in the electron transport chain is critical for cellular respiration. Mutations that significantly alter its structure or function are likely to be detrimental and selected against.
• What other Proteins can be used for Evolutionary Studies?
  • Other commonly used proteins include ribosomal RNA (rRNA), hemoglobin, and various enzymes involved in metabolism.
• How does DNA Sequencing Compare to Protein Sequencing in Evolutionary Studies?
  • DNA sequencing provides a more direct measure of genetic variation. However, protein sequences are useful for studying the functional consequences of mutations and can be more conserved than DNA sequences in some cases.
• Can Cytochrome c be Used to Study the Evolution of Bacteria?
  • While bacteria do have electron transport chains, they use different types of cytochromes. Cytochrome c is primarily used for studying eukaryotic evolution.
• What are the Limitations of using Cytochrome c Alone?
  • Relying solely on cytochrome c can provide a limited view of evolutionary relationships. It is best to combine cytochrome c data with other molecular and morphological data for a more comprehensive analysis.

Conclusion: The Power of Molecular Comparison

The cytochrome c comparison lab provides a valuable hands-on experience for understanding evolutionary relationships at the molecular level. By comparing the amino acid sequences of cytochrome c from different species, students can gain insights into how species have evolved over time and how molecular data can be used to construct phylogenetic trees. The principles learned in this lab extend to other areas of molecular biology and evolution, making it a cornerstone of biological education. Understanding the conservation and variation in cytochrome c highlights the delicate balance between stability and adaptation in the natural world.